Recombinant Human TPPP2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens tubulin polymerization promoting protein family member 2 (TPPP2) (NM_173846).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P59282
Entry Name TPPP2_HUMAN
Gene Names TPPP2 C14orf8
Alternative Gene Names C14orf8
Alternative Protein Names Tubulin polymerization-promoting protein family member 2 (Protein p25-beta) (TPPP/p18)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 170
Molecular Weight(Da) 18503
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMTDNTGYVSGYKGSGTYDKKTK
Background
Function FUNCTION: Probable regulator of microtubule dynamics required for sperm motility (Probable). In contrast to other members of the family, has no microtubule bundling activity (PubMed:17105200). {ECO:0000269|PubMed:17105200, ECO:0000305|PubMed:30680919}.
Pathway
Protein Families TPPP family
Tissue Specificity Expressed in spermatids (PubMed:23436708). Detected in liver cancer (at protein level) (PubMed:23436708). {ECO:0000269|PubMed:23436708}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8608045

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human TPPP2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.