Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens TNF receptor superfamily member 12A (TNFRSF12A) (NM_016639). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9NP84 |
| Entry Name | TNR12_HUMAN |
| Gene Names | TNFRSF12A FN14 |
| Alternative Gene Names | FN14 |
| Alternative Protein Names | Tumor necrosis factor receptor superfamily member 12A (Fibroblast growth factor-inducible immediate-early response protein 14) (FGF-inducible 14) (Tweak-receptor) (TweakR) (CD antigen CD266) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 129 |
| Molecular Weight(Da) | 13911 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ |
Background
| Function | FUNCTION: Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins. {ECO:0000269|PubMed:11728344}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |