Recombinant Human TMEM189 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens transmembrane protein 189 (TMEM189), transcript variant 1 (NM_199129).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID A5PLL7
Entry Name PDES1_HUMAN
Gene Names PEDS1 KUA PDES TMEM189
Alternative Gene Names KUA PDES TMEM189
Alternative Protein Names Plasmanylethanolamine desaturase (EC 1.14.19.77) (Plasmanylethanolamine desaturase 1) (Transmembrane protein 189)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 270
Molecular Weight(Da) 31135
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK
Background
Function FUNCTION: Plasmanylethanolamine desaturase involved in plasmalogen biogenesis in the endoplasmic reticulum membrane (PubMed:31604315, PubMed:32209662). Plasmalogens are glycerophospholipids with a hydrocarbon chain linked by a vinyl ether bond at the glycerol sn-1 position, and are involved in antioxidative and signaling mechanisms (PubMed:31604315). {ECO:0000269|PubMed:31604315, ECO:0000269|PubMed:32209662, ECO:0000303|PubMed:31604315}.
Pathway Lipid metabolism; fatty acid metabolism.
Protein Families Fatty acid desaturase CarF family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8728496

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human TMEM189 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.