Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens thyroid hormone responsive (THRSP) (NM_003251). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q92748 |
| Entry Name | THRSP_HUMAN |
| Gene Names | THRSP |
| Alternative Gene Names | |
| Alternative Protein Names | Thyroid hormone-inducible hepatic protein (Spot 14 protein) (S14) (SPOT14) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 146 |
| Molecular Weight(Da) | 16561 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW |
Background
| Function | FUNCTION: Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA (By similarity). May function as transcriptional coactivator. May modulate the transcription factor activity of THRB. {ECO:0000250, ECO:0000269|PubMed:17418816, ECO:0000269|PubMed:18299245}. |
| Pathway | |
| Protein Families | SPOT14 family |
| Tissue Specificity | Mainly expressed in tissues that synthesize triglycerides. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |