Recombinant Human TGIF2LY protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens TGFB induced factor homeobox 2 like Y-linked (TGIF2LY) (NM_139214).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8IUE0
Entry Name TF2LY_HUMAN
Gene Names TGIF2LY TGIFLY
Alternative Gene Names TGIFLY
Alternative Protein Names Homeobox protein TGIF2LY (TGF-beta-induced transcription factor 2-like protein) (TGFB-induced factor 2-like protein, Y-linked) (TGIF-like on the Y)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 185
Molecular Weight(Da) 20814
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLARSSPE
Background
Function FUNCTION: May have a transcription role in testis. May act as a competitor/regulator of TGIF2LX.
Pathway
Protein Families TALE/TGIF homeobox family
Tissue Specificity Specifically expressed in adult testis.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8616685

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human TGIF2LY protein
Copyright © 2021-present Echo Biosystems. All rights reserved.