Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens TAFA chemokine like family member 2 (TAFA2) (NM_178539). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8N3H0 |
| Entry Name | TAFA2_HUMAN |
| Gene Names | TAFA2 FAM19A2 |
| Alternative Gene Names | FAM19A2 |
| Alternative Protein Names | Chemokine-like protein TAFA-2 |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 131 |
| Molecular Weight(Da) | 14620 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSKRYLQKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH |
Background
| Function | FUNCTION: Has a role as neurotrophic factor involved in neuronal survival and neurobiological functions. {ECO:0000250|UniProtKB:Q7TPG7}. |
| Pathway | |
| Protein Families | TAFA family |
| Tissue Specificity | Brain-specific. {ECO:0000269|PubMed:15028294}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |