Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal 6xHis-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P34741 |
| Uniprot Entry Name | |
| Gene Names | SDC2 |
| Alternative Names | Syndecan-2; SYND2; Fibroglycan; Heparan Sulfate Proteoglycan Core Protein; HSPG; CD362; SDC2; HSPG1 |
| Expression Region | Partial (19-144aa) |
| Molecular Weight | 14.98 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm Filtered 20 mM Tris-Citrate, 150 mM NaCl, pH 7.0) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | Syndecan-2 is a member of the Syndecans family comprised of type I transmembrane heparan sulfate proteoglycans (HSPG) that are involved in the regulation of many cellular processes. Four sub-types of mammalian Syndecans have been reported and among them. Syndecan-2 plays a role in the cancer development. It can affect the basal and chemotherapy-induced apoptosis in osteosarcoma. It can also suppress MMP2 activation, suppressing metastasis. |
| Function | Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis (By similarity). |
| Involvement in disease | |
| Subcellular Location | Membrane, Single-pass type I membrane protein |
| Protein Families | Syndecan proteoglycan family |
| Tissue Specificity | |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
