Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens solute carrier family 51 subunit beta (SLC51B) (NM_178859). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q86UW2 |
| Entry Name | OSTB_HUMAN |
| Gene Names | SLC51B OSTB |
| Alternative Gene Names | OSTB |
| Alternative Protein Names | Organic solute transporter subunit beta (OST-beta) (Solute carrier family 51 subunit beta) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 128 |
| Molecular Weight(Da) | 14346 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES |
Background
| Function | FUNCTION: Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids. Modulates SLC51A glycosylation, membrane trafficking and stability activities. {ECO:0000269|PubMed:16317684}. |
| Pathway | |
| Protein Families | OST-beta family |
| Tissue Specificity | Widely expressed with a high expression in ileum. Expressed in testis, colon, liver, small intestine, kidney, ovary and adrenal gland; and at low levels in heart, lung, brain, pituitary, thyroid gland, uterus, prostate, mammary gland and fat. {ECO:0000269|PubMed:12719432, ECO:0000269|PubMed:16317684}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |