Recombinant Human SLC50A1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens solute carrier family 50 member 1 (SLC50A1), transcript variant 1 (NM_018845).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9BRV3
Entry Name SWET1_HUMAN
Gene Names SLC50A1 RAG1AP1 SCP
Alternative Gene Names RAG1AP1 SCP
Alternative Protein Names Sugar transporter SWEET1 (HsSWEET1) (RAG1-activating protein 1) (Solute carrier family 50 member 1) (Stromal cell protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 221
Molecular Weight(Da) 25030
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVPNPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT
Background
Function FUNCTION: Mediates sugar transport across membranes. May stimulate V(D)J recombination by the activation of RAG1. {ECO:0000269|PubMed:21107422}.
Pathway
Protein Families SWEET sugar transporter family
Tissue Specificity Ubiquitously expressed with highest expression in oviduct, epididymis and intestine. {ECO:0000269|PubMed:21107422}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8593106

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human SLC50A1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.