Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P62140 |
| Gene Names | PPP1CB |
| Alternative Names | MGC3672; PP 1B ; PP-1B; PP1B; PP1B_HUMAN; PP1beta; PPP1CB; PPP1CD; Protein phosphatase 1 beta; Protein phosphatase 1 catalytic subunit beta isoform; Protein phosphatase 1 delta; Protein phosphatase 1, catalytic subunit, beta isozyme; Protein phosphatase 1, catalytic subunit, delta isoform; Serine threonine protein phosphatase PP1 beta catalytic subunit; Serine/threonine-protein phosphatase PP1-beta catalytic subunit |
| Expression Region | Full Length of Mature Protein (2-327aa ) |
| Molecular Weight | 41.1 kDa |
| Protein Sequence | ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208). |
| Involvement in Disease | Noonan syndrome-like disorder with loose anagen hair 2 (NSLH2) |
| Subcellular Location | Cytoplasm, Nucleus, Nucleus, nucleoplasm, Nucleus, nucleolus |
| Protein Families | PPP phosphatase family, PP-1 subfamily |
| Tissue Specificity | PPP1CB |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |