Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens secretoglobin family 3A member 2 (SCGB3A2) (NM_054023). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q96PL1 |
| Entry Name | SG3A2_HUMAN |
| Gene Names | SCGB3A2 PNSP1 UGRP1 UNQ566/PRO1128 |
| Alternative Gene Names | PNSP1 UGRP1 |
| Alternative Protein Names | Secretoglobin family 3A member 2 (Pneumo secretory protein 1) (PnSP-1) (Uteroglobin-related protein 1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 93 |
| Molecular Weight(Da) | 10161 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV |
Background
| Function | FUNCTION: Secreted cytokine-like protein (PubMed:12847263). Binds to the scavenger receptor MARCO (PubMed:12847263). Can also bind to pathogens including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast (PubMed:12847263). Strongly inhibits phospholipase A2 (PLA2G1B) activity (PubMed:24213919). Seems to have anti-inflammatory effects in respiratory epithelium (By similarity). Also has anti-fibrotic activity in lung (PubMed:24213919). May play a role in fetal lung development and maturation (PubMed:24213919). Promotes branching morphogenesis during early stages of lung development (PubMed:24213919). In the pituitary, may inhibit production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) (By similarity). {ECO:0000250|UniProtKB:Q920H1, ECO:0000269|PubMed:12847263, ECO:0000269|PubMed:24213919}. |
| Pathway | |
| Protein Families | Secretoglobin family, UGRP subfamily |
| Tissue Specificity | Highly expressed in lung and trachea (PubMed:12406855, PubMed:12175512, PubMed:12847263). Detected throughout the airway epithelium in lung, with slightly higher expression in large airways (PubMed:12406855). Found in lung submucosal gland acinus where it localizes to serous-like cells (PubMed:12406855). Probably expressed in club/Clara cells of the bronchioles (PubMed:12847263). Not detected in other tissues tested (PubMed:12847263). {ECO:0000269|PubMed:12175512, ECO:0000269|PubMed:12406855, ECO:0000269|PubMed:12847263}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |