Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens S100 calcium binding protein A7A (S100A7A) (NM_176823). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q86SG5 |
| Entry Name | S1A7A_HUMAN |
| Gene Names | S100A7A S100A15 S100A7L1 |
| Alternative Gene Names | S100A15 S100A7L1 |
| Alternative Protein Names | Protein S100-A7A (S100 calcium-binding protein A15) (S100 calcium-binding protein A7-like 1) (S100 calcium-binding protein A7A) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 101 |
| Molecular Weight(Da) | 11305 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ |
Background
| Function | FUNCTION: May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. |
| Pathway | |
| Protein Families | S-100 family |
| Tissue Specificity | Overexpressed in psoriasis. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |