Specification
Description | Recombinant protein from the full-length sequence of Homo sapiens S100 calcium binding protein A3 (S100A3) (NM_002960). |
Organism | Homo sapiens (Human) |
Expression Host | Human Cells |
Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
Purity | Greater than 90% by SDS-PAGE gel |
Uniprot ID | P33764 |
Entry Name | S10A3_HUMAN |
Gene Names | S100A3 S100E |
Alternative Gene Names | S100E |
Alternative Protein Names | Protein S100-A3 (Protein S-100E) (S100 calcium-binding protein A3) |
Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
Length | 101 |
Molecular Weight(Da) | 11713 |
Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ |
Background
Function | FUNCTION: Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation. {ECO:0000269|PubMed:18083705}. |
Pathway | |
Protein Families | S-100 family |
Tissue Specificity | Skin specific, specifically expressed at the inner endocuticle of hair fibers. {ECO:0000269|PubMed:12470658}. |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |