Recombinant Human S100A3 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens S100 calcium binding protein A3 (S100A3) (NM_002960).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P33764
Entry Name S10A3_HUMAN
Gene Names S100A3 S100E
Alternative Gene Names S100E
Alternative Protein Names Protein S100-A3 (Protein S-100E) (S100 calcium-binding protein A3)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 101
Molecular Weight(Da) 11713
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
Background
Function FUNCTION: Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation. {ECO:0000269|PubMed:18083705}.
Pathway
Protein Families S-100 family
Tissue Specificity Skin specific, specifically expressed at the inner endocuticle of hair fibers. {ECO:0000269|PubMed:12470658}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8623195

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human S100A3 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.