Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens S100 calcium binding protein A2 (S100A2), transcript variant 1 (NM_005978). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P29034 |
| Entry Name | S10A2_HUMAN |
| Gene Names | S100A2 S100L |
| Alternative Gene Names | S100L |
| Alternative Protein Names | Protein S100-A2 (CAN19) (Protein S-100L) (S100 calcium-binding protein A2) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 98 |
| Molecular Weight(Da) | 11117 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP |
Background
| Function | FUNCTION: May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes. May also play a role in suppressing tumor cell growth. {ECO:0000269|PubMed:1372446, ECO:0000269|PubMed:22399290}. |
| Pathway | |
| Protein Families | S-100 family |
| Tissue Specificity | A subset of epithelial cells including normal human mammary epithelial cells and keratinocytes. {ECO:0000269|PubMed:1372446}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |