Recombinant Human RPS27L protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens ribosomal protein S27 like (RPS27L) (NM_015920).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q71UM5
Entry Name RS27L_HUMAN
Gene Names RPS27L
Alternative Gene Names
Alternative Protein Names 40S ribosomal protein S27-like (Small ribosomal subunit protein eS27-like)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 84
Molecular Weight(Da) 9477
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
Background
Function
Pathway
Protein Families Eukaryotic ribosomal protein eS27 family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8676435

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human RPS27L protein
Copyright © 2021-present Echo Biosystems. All rights reserved.