Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens ring finger protein 7 (RNF7), transcript variant 1 (NM_014245). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9UBF6 |
| Entry Name | RBX2_HUMAN |
| Gene Names | RNF7 RBX2 ROC2 SAG |
| Alternative Gene Names | RBX2 ROC2 SAG |
| Alternative Protein Names | RING-box protein 2 (Rbx2) (CKII beta-binding protein 1) (CKBBP1) (RING finger protein 7) (Regulator of cullins 2) (Sensitive to apoptosis gene protein) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 113 |
| Molecular Weight(Da) | 12683 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK |
Background
| Function | FUNCTION: Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription (PubMed:10851089). CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (By similarity). Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents. {ECO:0000250|UniProtKB:P62877, ECO:0000269|PubMed:10851089}. |
| Pathway | Protein modification; protein ubiquitination. |
| Protein Families | RING-box family |
| Tissue Specificity | Expressed in heart, liver, skeletal muscle and pancreas. At very low levels expressed in brain, placenta and lung. {ECO:0000269|PubMed:10512750}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |