Recombinant Human RNASE6 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens ribonuclease A family member k6 (RNASE6) (NM_005615).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q93091
Entry Name RNAS6_HUMAN
Gene Names RNASE6 RNS6
Alternative Gene Names RNS6
Alternative Protein Names Ribonuclease K6 (RNase K6) (EC 3.1.27.-)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 150
Molecular Weight(Da) 17196
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL
Background
Function FUNCTION: Ribonuclease which shows a preference for the pyrimidines uridine and cytosine (PubMed:8836175, PubMed:27013146). Has potent antibacterial activity against a range of Gram-positive and Gram-negative bacteria, including P.aeruginosa, A.baumanii, M.luteus, S.aureus, E.faecalis, E.faecium, S.saprophyticus and E.coli (PubMed:25075772, PubMed:27089320). Causes loss of bacterial membrane integrity, and also promotes agglutination of Gram-negative bacteria (PubMed:27089320). Probably contributes to urinary tract sterility (PubMed:25075772). Bactericidal activity is independent of RNase activity (PubMed:27089320). {ECO:0000269|PubMed:25075772, ECO:0000269|PubMed:27013146, ECO:0000269|PubMed:27089320, ECO:0000269|PubMed:8836175}.
Pathway
Protein Families Pancreatic ribonuclease family
Tissue Specificity Highly expressed in spleen (at protein level) (PubMed:8836175, PubMed:25075772). Has little or no expression in healthy kidneys (at protein level) (PubMed:25075772). Detected in interstitial leukocytes in infected kidneys (at protein level) (PubMed:25075772). Expressed in ureter where it localizes to urothelial and submucosal leukocytes (at protein level) (PubMed:25075772). Strong expression in lung and thymus, and lower expression in heart, placenta, pancreas, liver, brain and skeletal muscle (PubMed:8836175, PubMed:25075772). Also expressed in monocytes and neutrophils (PubMed:8836175). {ECO:0000269|PubMed:25075772, ECO:0000269|PubMed:8836175}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8667485

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human RNASE6 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.