Recombinant Human REXO2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens RNA exonuclease 2 (REXO2) (NM_015523).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9Y3B8
Entry Name ORN_HUMAN
Gene Names REXO2 SFN SMFN CGI-114
Alternative Gene Names SFN SMFN
Alternative Protein Names Oligoribonuclease, mitochondrial (EC 3.1.-.-) (RNA exonuclease 2 homolog) (Small fragment nuclease)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 237
Molecular Weight(Da) 26833
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS
Background
Function FUNCTION: 3'-to-5'exoribonuclease that preferentially degrades DNA and RNA oligonucleotides composed of only two nucleotides (PubMed:31588022, PubMed:30926754, PubMed:32365187, PubMed:23741365). Binds and degrades longer oligonucleotides with a lower affinity (PubMed:31588022, PubMed:30926754, PubMed:32365187). Plays dual roles in mitochondria, scavenging nanoRNAs (small RNA oligonucleotides of <5 nucleotides) that are produced by the degradosome and clearing short RNAs that are generated by RNA processing (PubMed:31588022, PubMed:30926754, PubMed:32365187). Essential for correct initiation of mitochondrial transcription, degrading mitochondrial RNA dinucleotides to prevent RNA-primed transcription at non-canonical sites in the mitochondrial genome (PubMed:31588022). Essential for embryonic development (By similarity). {ECO:0000250|UniProtKB:Q9D8S4, ECO:0000269|PubMed:23741365, ECO:0000269|PubMed:30926754, ECO:0000269|PubMed:31588022, ECO:0000269|PubMed:32365187}.; FUNCTION: [Isoform 3]: 3'-to-5'exoribonuclease that preferentially degrades DNA and RNA oligonucleotides composed of only two nucleotides. {ECO:0000269|PubMed:10851236, ECO:0000269|PubMed:16682444}.
Pathway
Protein Families Oligoribonuclease family
Tissue Specificity Highly expressed in the heart and at lower levels in the lymph nodes, brain, lung, liver, spleen and thymus. {ECO:0000269|PubMed:10851236}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8869235

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human REXO2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.