Recombinant Human REG4 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens regenerating family member 4 (REG4), transcript variant 2 (NM_032044).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9BYZ8
Entry Name REG4_HUMAN
Gene Names REG4 GISP RELP
Alternative Gene Names GISP RELP
Alternative Protein Names Regenerating islet-derived protein 4 (REG-4) (Gastrointestinal secretory protein) (REG-like protein) (Regenerating islet-derived protein IV) (Reg IV)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 158
Molecular Weight(Da) 18230
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Background
Function FUNCTION: Calcium-independent lectin displaying mannose-binding specificity and able to maintain carbohydrate recognition activity in an acidic environment. May be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium. {ECO:0000269|PubMed:12819006, ECO:0000269|PubMed:20692269}.
Pathway
Protein Families
Tissue Specificity Highly expressed in the gastrointestinal tract including the duodenum, jejunum, ileum, ileocecum, appendix, descending colon, pancreas and small intestine. Weakly expressed in normal colon and stomach. Strongly expressed in most colorectal tumors than in normal colon. Preferentially expressed in mucinous tumors and in some cases neuro-endocrine tumors. Expressed in mucus-secreting cells and enterocyte-like cells. In small intestine expressed at the basal perinuclear zone of goblet cells. {ECO:0000269|PubMed:11311942, ECO:0000269|PubMed:12455032, ECO:0000269|PubMed:12819006}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8617587

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human REG4 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.