Recombinant Human REEP5 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens receptor accessory protein 5 (REEP5) (NM_005669).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q00765
Entry Name REEP5_HUMAN
Gene Names REEP5 C5orf18 DP1 TB2
Alternative Gene Names C5orf18 DP1 TB2
Alternative Protein Names Receptor expression-enhancing protein 5 (Polyposis locus protein 1) (Protein TB2)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 189
Molecular Weight(Da) 21493
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST
Background
Function FUNCTION: May promote functional cell surface expression of olfactory receptors.
Pathway
Protein Families DP1 family
Tissue Specificity Expressed in circumvallate papillae and testis. {ECO:0000269|PubMed:16720576}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8733245

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human REEP5 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.