Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens retinol binding protein 2 (RBP2) (NM_004164). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P50120 |
| Entry Name | RET2_HUMAN |
| Gene Names | RBP2 CRBP2 |
| Alternative Gene Names | CRBP2 |
| Alternative Protein Names | Retinol-binding protein 2 (Cellular retinol-binding protein II) (CRBP-II) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 134 |
| Molecular Weight(Da) | 15707 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK |
Background
| Function | FUNCTION: Intracellular transport of retinol. |
| Pathway | |
| Protein Families | Calycin superfamily, Fatty-acid binding protein (FABP) family |
| Tissue Specificity | Higher expression in adult small intestine and to a much lesser extent in fetal kidney. {ECO:0000269|PubMed:11274389}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |