Recombinant Human RASL10A protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens RAS like family 10 member A (RASL10A) (NM_006477).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q92737
Entry Name RSLAA_HUMAN
Gene Names RASL10A RRP22
Alternative Gene Names RRP22
Alternative Protein Names Ras-like protein family member 10A (EC 3.6.5.2) (Ras-like protein RRP22) (Ras-related protein on chromosome 22)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 203
Molecular Weight(Da) 22541
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MGGSLRVAVLGAPGVGKTAIIRQFLFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRLRFGPRRALAALVRRGWRCGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM
Background
Function FUNCTION: Potent inhibitor of cellular proliferation. {ECO:0000269|PubMed:15833841}.
Pathway
Protein Families Small GTPase superfamily, Ras family
Tissue Specificity Expression appears to be strictly limited to the central nervous system. {ECO:0000269|PubMed:8975699}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8821086

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human RASL10A protein
Copyright © 2021-present Echo Biosystems. All rights reserved.