Specification
Description | Recombinant protein from the full-length sequence of Homo sapiens pyrin domain containing 1 (PYDC1) (NM_152901). |
Organism | Homo sapiens (Human) |
Expression Host | Human Cells |
Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
Purity | Greater than 90% by SDS-PAGE gel |
Uniprot ID | Q8WXC3 |
Entry Name | PYDC1_HUMAN |
Gene Names | PYDC1 ASC2 ASCI POP1 PYC1 |
Alternative Gene Names | ASC2 ASCI POP1 PYC1 |
Alternative Protein Names | Pyrin domain-containing protein 1 (PAAD-only protein 1) (Pyrin-only protein 1) (cellular POP1) (cPOP1) |
Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
Length | 89 |
Molecular Weight(Da) | 10107 |
Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLEEAARLQRAA |
Background
Function | FUNCTION: Associates with PYCARD/ASC and modulates its ability to collaborate with MEFV/pyrin and NLRP3/cryopyrin in NF-kappa-B and pro-caspase-1 activation. Suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS. {ECO:0000269|PubMed:12656673, ECO:0000269|PubMed:24871464}. |
Pathway | |
Protein Families | |
Tissue Specificity | Predominantly expressed in monocytes, macrophages and granulocytes. {ECO:0000269|PubMed:12656673}. |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |