Recombinant Human PYDC1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens pyrin domain containing 1 (PYDC1) (NM_152901).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8WXC3
Entry Name PYDC1_HUMAN
Gene Names PYDC1 ASC2 ASCI POP1 PYC1
Alternative Gene Names ASC2 ASCI POP1 PYC1
Alternative Protein Names Pyrin domain-containing protein 1 (PAAD-only protein 1) (Pyrin-only protein 1) (cellular POP1) (cPOP1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 89
Molecular Weight(Da) 10107
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLEEAARLQRAA
Background
Function FUNCTION: Associates with PYCARD/ASC and modulates its ability to collaborate with MEFV/pyrin and NLRP3/cryopyrin in NF-kappa-B and pro-caspase-1 activation. Suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS. {ECO:0000269|PubMed:12656673, ECO:0000269|PubMed:24871464}.
Pathway
Protein Families
Tissue Specificity Predominantly expressed in monocytes, macrophages and granulocytes. {ECO:0000269|PubMed:12656673}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8770775

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PYDC1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.