Recombinant Human PRSS55 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens serine protease 55 (PRSS55), transcript variant 2 (NM_001197020).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q6UWB4
Entry Name PRS55_HUMAN
Gene Names PRSS55 TSP1 UNQ9391/PRO34284
Alternative Gene Names TSP1
Alternative Protein Names Serine protease 55 (EC 3.4.21.-) (Testis serine protease 1) (T-SP1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 352
Molecular Weight(Da) 38856
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MLLFSVLLLLSLVTGTQLGPRTPLPEAGVAILGRARGAHRPQPPHPPSPVSECGDRSIFEGRTRYSRITGGMEAEVGEFPWQVSIQARSEPFCGGSILNKWWILTAAHCLYSEELFPEELSVVLGTNDLTSPSMEIKEVASIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQPGPATWRECWVAGWGQTNAADKNSVKTDLMKAPMVIMDWEECSKMFPKLTKNMLCAGYKNESYDACKGDSGGPLVCTPEPGEKWYQVGIISWGKSCGEKNTPGIYTSLVNYNLWIEKVTQLEGRPFNAEKRRTSVKQKPMGSPVSGVPEPGSPRSWLLLCPLSHVLFRAILY
Background
Function FUNCTION: Probable serine protease, which plays a crucial role in the fertility of male mice including sperm migration and sperm-egg interaction. {ECO:0000250|UniProtKB:Q14BX2}.
Pathway
Protein Families Peptidase S1 family
Tissue Specificity Only detected in testis. Expressed in spermatogonia, spermatocytes, spermatids, Leydig and Sertoli cells. Expressed in prostate cancer and ovarian cancer (at protein level). {ECO:0000269|PubMed:18844450, ECO:0000269|PubMed:23436708}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8846267

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PRSS55 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.