Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens proline rich 4 (PRR4), transcript variant 2 (NM_007244). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q16378 |
| Entry Name | PROL4_HUMAN |
| Gene Names | PRR4 LPRP PROL4 |
| Alternative Gene Names | LPRP PROL4 |
| Alternative Protein Names | Proline-rich protein 4 (Lacrimal proline-rich protein) (Nasopharyngeal carcinoma-associated proline-rich protein 4) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 134 |
| Molecular Weight(Da) | 15097 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MLLVLLSVVLLALSSAQSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQQRPPKPGGHHRHPPPPPFQNQQRPPRRGHRQLSLPRFPSVSLQEASSFFQRDRPARHPQEQPLW |
Background
| Function | |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Abundantly expressed in lacrimal gland where it is found in the acinar cells but not in the intralobular ducts. Also found in the submandibular gland, the parotid and sublingual glands. {ECO:0000269|PubMed:7544782}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |