Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens prokineticin 2 (PROK2), transcript variant 2 (NM_021935). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9HC23 |
| Entry Name | PROK2_HUMAN |
| Gene Names | PROK2 BV8 |
| Alternative Gene Names | BV8 |
| Alternative Protein Names | Prokineticin-2 (PK2) (Protein Bv8 homolog) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 129 |
| Molecular Weight(Da) | 14314 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK |
Background
| Function | FUNCTION: May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle. |
| Pathway | |
| Protein Families | AVIT (prokineticin) family |
| Tissue Specificity | Expressed in the testis and, at low levels, in the small intestine. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |