Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens protein phosphatase 1 regulatory inhibitor subunit 14D (PPP1R14D), transcript variant 1 (NM_017726). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9NXH3 |
| Entry Name | PP14D_HUMAN |
| Gene Names | PPP1R14D GBPI |
| Alternative Gene Names | GBPI |
| Alternative Protein Names | Protein phosphatase 1 regulatory subunit 14D (Gastrointestinal and brain-specific PP1-inhibitory protein 1) (GBPI-1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 145 |
| Molecular Weight(Da) | 16508 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRLSRPQK |
Background
| Function | FUNCTION: Inhibitor of PPP1CA. Has inhibitory activity only when phosphorylated, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction. {ECO:0000269|PubMed:12974676}. |
| Pathway | |
| Protein Families | PP1 inhibitor family |
| Tissue Specificity | Detected in colon, intestine, kidney and brain cortex. {ECO:0000269|PubMed:12974676}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |