Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens protein phosphatase 1 regulatory inhibitor subunit 14B (PPP1R14B) (NM_138689). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q96C90 |
| Entry Name | PP14B_HUMAN |
| Gene Names | PPP1R14B PLCB3N PNG |
| Alternative Gene Names | PLCB3N PNG |
| Alternative Protein Names | Protein phosphatase 1 regulatory subunit 14B (Phospholipase C-beta-3 neighbouring gene protein) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 147 |
| Molecular Weight(Da) | 15911 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK |
Background
| Function | FUNCTION: Inhibitor of PPP1CA. Has over 50-fold higher inhibitory activity when phosphorylated (By similarity). {ECO:0000250}. |
| Pathway | |
| Protein Families | PP1 inhibitor family |
| Tissue Specificity | Ubiquitous. Expressed at low levels. {ECO:0000269|PubMed:8838322}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |