Specification
| Organism | Homo sapiens (Human) |
| Expression Host | in vitro E.coli expression system |
| Protein Tag | N-terminal 10xHis-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | Q9NPC2 |
| Gene Names | KCNK9 |
| Alternative Names | (Acid-sensitive potassium channel protein TASK-3)(TWIK-related acid-sensitive K(+) channel 3)(Two pore potassium channel KT3.2)(Two pore K(+) channel KT3.2) |
| Expression Region | 1-374aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.270 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-362℃. |
| Protein Length | Full Length |
| Molecular Weight | 48.3 kDa |
| Protein Sequence | MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV |
Background
| Research Areas | Neuroscience |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |