Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens RNA polymerase II subunit J2 (POLR2J2) (NM_032959). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9GZM3 |
| Entry Name | RPB1B_HUMAN |
| Gene Names | POLR2J2 |
| Alternative Gene Names | |
| Alternative Protein Names | DNA-directed RNA polymerase II subunit RPB11-b1 (RNA polymerase II subunit B11-b1) (RPB11b1) (DNA-directed RNA polymerase II subunit J2) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 115 |
| Molecular Weight(Da) | 13088 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MNAPPAFESFLLFEGEKITINKDTKVPKACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP |
Background
| Function | FUNCTION: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft (By similarity). {ECO:0000250}. |
| Pathway | |
| Protein Families | Archaeal Rpo11/eukaryotic RPB11/RPC19 RNA polymerase subunit family |
| Tissue Specificity | Ubiquitously expressed. {ECO:0000269|PubMed:11747469}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |