Recombinant Human Platelet basic protein(PPBP),partial (Active)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 95% as determined by SDS-PAGE.
Uniprot ID P02775
Uniprot Entry Name
Gene Names PPBP
Alternative Names Platelet Basic Protein; PBP; C-X-C Motif Chemokine 7; Leukocyte-Derived Growth Factor; LDGF; Macrophage-Derived Growth Factor; MDGFSmall-Inducible Cytokine B7; PPBP; CTAP3; CXCL7; SCYB7; TGB1; THBGB1
Expression Region Partial (59-128aa)
Molecular Weight 7.6 kDa
Endotoxin Less than 1.0 EU/µg as determined by LAL method.
Sequence AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4)
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Human Chemokine (C-X-C motif) Ligand 7 (CXCL7), also known as neutrophil activating peptide 2 (NAP-2), is a member of the CXC chemokines containing an ELR domain (Glu-Leu-Arg tripeptide motif). Similar to other ELR domain containing CXC chemokines, such as IL-8 and the GRO proteins, CXCL7 binds CXCR2, chemoattracts and activates neutrophils. CXCL7, Connective Tissue Activating Protein III (CTAPIII) and βthrombogulin (βTG), are proteolytically processed carboxylterminal fragments of platelet basic protein (PBP) which is found in the alphagranules of human platelets. Although CTAPIII, βTG, and PBP represent amino-terminal extended variants of NAP2 and possess the same CXC chemokine domains, these proteins do not exhibit CXCL7/NAP2 activity. CXCL7 induces cell migration through the G-protein-linked receptor CXCR-2.
Function LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
Involvement in disease
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Tissue Specificity
Pathway Chemokinesignalingpathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$261.00
In stock
SKU
EB-CAPHU3636

Recombinant Human Platelet basic protein(PPBP),partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Platelet basic protein(PPBP),partial (Active)
Copyright © 2026-present Echo Bio. All rights reserved.