Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens pleckstrin homology like domain family A member 3 (PHLDA3), transcript variant 1 (NM_012396). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9Y5J5 |
| Entry Name | PHLA3_HUMAN |
| Gene Names | PHLDA3 TIH1 |
| Alternative Gene Names | TIH1 |
| Alternative Protein Names | Pleckstrin homology-like domain family A member 3 (TDAG51/Ipl homolog 1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 127 |
| Molecular Weight(Da) | 13891 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS |
Background
| Function | FUNCTION: p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor. {ECO:0000269|PubMed:19203586}. |
| Pathway | |
| Protein Families | PHLDA3 family |
| Tissue Specificity | Widely expressed with lowest expression in liver and spleen. {ECO:0000269|PubMed:10594239}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |