Recombinant Human PCOTH protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens Pro-X-Gly collagen triple helix like repeat containing (PCOTH), transcript variant 2 (NM_001135816).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID B2RNN3
Entry Name C1T9B_HUMAN
Gene Names C1QTNF9B
Alternative Gene Names
Alternative Protein Names Complement C1q and tumor necrosis factor-related protein 9B (C1q/TNF-related protein 9B) (CTRP9B) (Complement C1q and tumor necrosis factor-related protein 9-like)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 333
Molecular Weight(Da) 34713
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGCPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDVPIKFDKILYNEFNHYDTAVGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTRDAYVSSEDQASGSIVLQLKLGDEMWLQVTGGERFNGLFADEDDDTTFTGFLLFSSQ
Background
Function FUNCTION: Probable adipokine. Activates AMPK, AKT, and p44/42 MAPK signaling pathways. {ECO:0000250|UniProtKB:Q4ZJN1}.
Pathway
Protein Families
Tissue Specificity Expressed at low levels. Not expressed in adipose tissues. {ECO:0000269|PubMed:19666007}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8792127

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PCOTH protein
Copyright © 2021-present Echo Biosystems. All rights reserved.