Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens pterin-4 alpha-carbinolamine dehydratase 2 (PCBD2) (NM_032151). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9H0N5 |
| Entry Name | PHS2_HUMAN |
| Gene Names | PCBD2 DCOH2 DCOHM |
| Alternative Gene Names | DCOH2 DCOHM |
| Alternative Protein Names | Pterin-4-alpha-carbinolamine dehydratase 2 (PHS 2) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase 2) (DcoH-like protein DCoHm) (Dimerization cofactor of hepatocyte nuclear factor 1 from muscle) (HNF-1-alpha dimerization cofactor) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 130 |
| Molecular Weight(Da) | 14365 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV |
Background
| Function | FUNCTION: Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2 (By similarity). {ECO:0000250}.; FUNCTION: Regulates the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity. {ECO:0000269|PubMed:11980910}. |
| Pathway | |
| Protein Families | Pterin-4-alpha-carbinolamine dehydratase family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |