Recombinant Human OLIG1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens oligodendrocyte transcription factor 1 (OLIG1) (NM_138983).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8TAK6
Entry Name OLIG1_HUMAN
Gene Names OLIG1 BHLHB6 BHLHE21
Alternative Gene Names BHLHB6 BHLHE21
Alternative Protein Names Oligodendrocyte transcription factor 1 (Oligo1) (Class B basic helix-loop-helix protein 6) (bHLHb6) (Class E basic helix-loop-helix protein 21) (bHLHe21)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 271
Molecular Weight(Da) 27905
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
Background
Function FUNCTION: Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube (By similarity). {ECO:0000250, ECO:0000269|PubMed:10719889}.
Pathway
Protein Families
Tissue Specificity Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable. {ECO:0000269|PubMed:11526205}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8629325

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human OLIG1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.