Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens neuronal regeneration related protein (NREP), transcript variant 1 (NM_004772). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q16612 |
| Entry Name | NREP_HUMAN |
| Gene Names | NREP C5orf13 P311 |
| Alternative Gene Names | C5orf13 P311 |
| Alternative Protein Names | Neuronal regeneration-related protein (Neuronal protein 3.1) (Protein p311) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 68 |
| Molecular Weight(Da) | 7909 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF |
Background
| Function | FUNCTION: May have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration (By similarity). May also have functions in cellular differentiation (By similarity). Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboid migration. Increases retinoic-acid regulation of lipid-droplet biogenesis (By similarity). Down-regulates the expression of TGFB1 and TGFB2 but not of TGFB3 (By similarity). May play a role in the regulation of alveolar generation. {ECO:0000250, ECO:0000269|PubMed:11358844, ECO:0000269|PubMed:16229809}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Expressed in lung (at protein level). {ECO:0000269|PubMed:16484684}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |