Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens nuclear receptor 2C2 associated protein (NR2C2AP), transcript variant 2 (NM_176880). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q86WQ0 |
| Entry Name | NR2CA_HUMAN |
| Gene Names | NR2C2AP TRA16 |
| Alternative Gene Names | TRA16 |
| Alternative Protein Names | Nuclear receptor 2C2-associated protein (TR4 orphan receptor-associated 16 kDa protein) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 139 |
| Molecular Weight(Da) | 15876 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV |
Background
| Function | FUNCTION: May act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes. {ECO:0000269|PubMed:12486131}. |
| Pathway | |
| Protein Families | NR2C2AP family |
| Tissue Specificity | Expressed in all tissues examined, with highest expression in heart, skeletal muscle and pancreas. {ECO:0000269|PubMed:12486131}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |