Recombinant Human NMRK1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens nicotinamide riboside kinase 1 (NMRK1), transcript variant 1 (NM_017881).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9NWW6
Entry Name NRK1_HUMAN
Gene Names NMRK1 C9orf95 NRK1
Alternative Gene Names C9orf95 NRK1
Alternative Protein Names Nicotinamide riboside kinase 1 (NRK 1) (NmR-K 1) (EC 2.7.1.22) (Nicotinic acid riboside kinase 1) (EC 2.7.1.173) (Ribosylnicotinamide kinase 1) (RNK 1) (Ribosylnicotinic acid kinase 1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 199
Molecular Weight(Da) 23193
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA
Background
Function FUNCTION: Catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN). The enzyme also phosphorylates the antitumor drugs tiazofurin and 3-deazaguanosine. {ECO:0000269|PubMed:15137942}.
Pathway Cofactor biosynthesis; NAD(+) biosynthesis.
Protein Families Uridine kinase family, NRK subfamily
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8607706

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human NMRK1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.