Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens nescient helix-loop-helix 1 (NHLH1) (NM_005598). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q02575 |
| Entry Name | HEN1_HUMAN |
| Gene Names | NHLH1 BHLHA35 HEN1 |
| Alternative Gene Names | BHLHA35 HEN1 |
| Alternative Protein Names | Helix-loop-helix protein 1 (HEN-1) (Class A basic helix-loop-helix protein 35) (bHLHa35) (Nescient helix loop helix 1) (NSCL-1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 133 |
| Molecular Weight(Da) | 14618 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV |
Background
| Function | FUNCTION: May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system. |
| Pathway | |
| Protein Families | |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |