Recombinant Human Myelin-oligodendrocyte glycoprotein(MOG),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q16653
Gene Names MOG
Alternative Names BTN6; BTNL11; MGC26137; MOG alpha 5; MOG alpha 6; MOG AluA; MOG AluB; MOG; MOG Ig AluB; MOG_HUMAN; MOGIG2; Myelin oligodendrocyte glycoprotein; Myelin-oligodendrocyte glycoprotein; NRCLP7
Expression Region Full Length of Mature Protein(30-154aa )
Molecular Weight 17.9 kDa
Protein Sequence GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity MOG
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE3HU619208

Recombinant Human Myelin-oligodendrocyte glycoprotein(MOG),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Myelin-oligodendrocyte glycoprotein(MOG),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.