Specification
Description | Recombinant protein from the full-length sequence of Homo sapiens metallothionein 1F (MT1F), transcript variant 1 (NM_005949). |
Organism | Homo sapiens (Human) |
Expression Host | Human Cells |
Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
Purity | Greater than 90% by SDS-PAGE gel |
Uniprot ID | P04733 |
Entry Name | MT1F_HUMAN |
Gene Names | MT1F PRO0376 |
Alternative Gene Names | |
Alternative Protein Names | Metallothionein-1F (MT-1F) (Metallothionein-IF) (MT-IF) |
Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
Length | 61 |
Molecular Weight(Da) | 6086 |
Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD |
Background
Function | FUNCTION: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. |
Pathway | |
Protein Families | Metallothionein superfamily, Type 1 family |
Tissue Specificity |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |