Recombinant Human MPPED2 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens metallophosphoesterase domain containing 2 (MPPED2), transcript variant 1 (NM_001584).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q15777
Entry Name MPPD2_HUMAN
Gene Names MPPED2 C11orf8 FAM1B
Alternative Gene Names C11orf8 FAM1B
Alternative Protein Names Metallophosphoesterase MPPED2 (EC 3.1.-.-) (Fetal brain protein 239) (239FB) (Metallophosphoesterase domain-containing protein 2)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 294
Molecular Weight(Da) 33360
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
Background
Function FUNCTION: Displays low metallophosphoesterase activity (in vitro). May play a role in the development of the nervous system. {ECO:0000250|UniProtKB:B1WBP0}.
Pathway
Protein Families UPF0046 family
Tissue Specificity Expressed predominantly in fetal brain.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8826396

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human MPPED2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.