Recombinant Human MORN4 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens MORN repeat containing 4 (MORN4), transcript variant 1 (NM_178832).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8NDC4
Entry Name MORN4_HUMAN
Gene Names MORN4 C10orf83
Alternative Gene Names C10orf83
Alternative Protein Names MORN repeat-containing protein 4 (Protein 44050) (Retinophilin)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 146
Molecular Weight(Da) 16236
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA
Background
Function FUNCTION: Plays a role in promoting axonal degeneration following neuronal injury by toxic insult or trauma. {ECO:0000250|UniProtKB:Q6PGF2}.
Pathway
Protein Families
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8832077

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human MORN4 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.