Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens mitochondrial inner membrane organizing system 1 (MICOS10), transcript variant 1 (NM_001032363). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q5TGZ0 |
| Entry Name | MIC10_HUMAN |
| Gene Names | MICOS10 C1orf151 MIC10 MINOS1 |
| Alternative Gene Names | C1orf151 MIC10 MINOS1 |
| Alternative Protein Names | MICOS complex subunit MIC10 (Mitochondrial inner membrane organizing system protein 1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 78 |
| Molecular Weight(Da) | 8808 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ |
Background
| Function | FUNCTION: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. {ECO:0000269|PubMed:22114354}. |
| Pathway | |
| Protein Families | MICOS complex subunit Mic10 family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |