Recombinant Human MICOS10 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens mitochondrial inner membrane organizing system 1 (MICOS10), transcript variant 1 (NM_001032363).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q5TGZ0
Entry Name MIC10_HUMAN
Gene Names MICOS10 C1orf151 MIC10 MINOS1
Alternative Gene Names C1orf151 MIC10 MINOS1
Alternative Protein Names MICOS complex subunit MIC10 (Mitochondrial inner membrane organizing system protein 1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 78
Molecular Weight(Da) 8808
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
Background
Function FUNCTION: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. {ECO:0000269|PubMed:22114354}.
Pathway
Protein Families MICOS complex subunit Mic10 family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8629436

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human MICOS10 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.