Recombinant Human METTL18 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens methyltransferase like 18 (METTL18), transcript variant 1 (NM_033418).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID O95568
Entry Name MET18_HUMAN
Gene Names METTL18 ASTP2 C1orf156
Alternative Gene Names ASTP2 C1orf156
Alternative Protein Names Histidine protein methyltransferase 1 homolog (EC 2.1.1.85) (Arsenic-transactivated protein 2) (AsTP2) (Methyltransferase-like protein 18)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 372
Molecular Weight(Da) 42148
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MTFQFNFTIEDHLENELTPIRDGALTLDSSKELSVSESQKGEERDRKCSAEQFDLPQDHLWEHKSMENAAPSQDTDSPLSAASSSRNLEPHGKQPSLRAAKEHAMPKDLKKMLENKVIETLPGFQHVKLSVVKTILLKENFPGENIVSKSFSSHSDLITGVYEGGLKIWECTFDLLAYFTKAKVKFAGKKVLDLGCGSGLLGITAFKGGSKEIHFQDYNSMVIDEVTLPNVVANSTLEDEENDVNEPDVKRCRKPKVTQLYKCRFFSGEWSEFCKLVLSSEKLFVKYDLILTSETIYNPDYYSNLHQTFLRLLSKNGRVLLASKAHYFGVGGGVHLFQKFVEERDVFKTRILKIIDEGLKRFIIEITFKFPG
Background
Function FUNCTION: Protein-L-histidine N-tele-methyltransferase that specifically monomethylates RPL3 (PubMed:23349634, PubMed:33693809). Through the methylation of RPL3 regulates the dynamics of pre-rRNA processing, ribosome biogenesis, and translation (PubMed:33693809). {ECO:0000269|PubMed:23349634, ECO:0000269|PubMed:33693809}.
Pathway
Protein Families Methyltransferase superfamily, METTL18 family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8816525

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human METTL18 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.