Recombinant Human METTL1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens methyltransferase like 1 (METTL1), transcript variant 1 (NM_005371).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9UBP6
Entry Name TRMB_HUMAN
Gene Names METTL1 C12orf1
Alternative Gene Names C12orf1
Alternative Protein Names tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (Methyltransferase-like protein 1) (mRNA (guanine-N(7)-)-methyltransferase) (EC 2.1.1.-) (miRNA (guanine-N(7)-)-methyltransferase) (EC 2.1.1.-) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 276
Molecular Weight(Da) 31471
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
Background
Function FUNCTION: Methyltransferase that mediates the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs) (PubMed:12403464, PubMed:31031084, PubMed:31031083). Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA (PubMed:12403464, PubMed:31031084). Also acts as a methyltransferase for a subset of internal N(7)-methylguanine in mRNAs (PubMed:31031084). Internal N(7)-methylguanine methylation of mRNAs regulates translation (PubMed:31031084). Also methylates a specific subset of miRNAs, such as let-7 (PubMed:31031083). N(7)-methylguanine methylation of let-7 miRNA promotes let-7 miRNA processing by disrupting an inhibitory secondary structure within the primary miRNA transcript (pri-miRNA) (PubMed:31031083). Acts as a regulator of embryonic stem cell self-renewal and differentiation (By similarity). {ECO:0000255|HAMAP-Rule:MF_03055, ECO:0000269|PubMed:12403464, ECO:0000269|PubMed:31031083, ECO:0000269|PubMed:31031084}.
Pathway tRNA modification; N(7)-methylguanine-tRNA biosynthesis.
Protein Families Class I-like SAM-binding methyltransferase superfamily, TrmB family
Tissue Specificity Ubiquitous. {ECO:0000269|PubMed:10329009}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8723916

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human METTL1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.