Recombinant Human LRATD1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens LRAT domain containing 1 (LRATD1), transcript variant 1 (NM_145175).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96KN4
Entry Name LRAT1_HUMAN
Gene Names LRATD1 FAM84A NSE1
Alternative Gene Names FAM84A NSE1
Alternative Protein Names Protein LRATD1 (LRAT domain-containing 1) (Neurologic sensory protein 1) (NSE1) (Protein FAM84A)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 292
Molecular Weight(Da) 32491
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE
Background
Function FUNCTION: May play a role in cell morphology and motility. {ECO:0000269|PubMed:16820875}.
Pathway
Protein Families LRATD family
Tissue Specificity Only detected in testis. Highly expressed in colon cancer cells. {ECO:0000269|PubMed:16820875}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8601455

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human LRATD1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.