Recombinant Human LHFPL2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens LHFPL tetraspan subfamily member 2 (LHFPL2) (NM_005779).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q6ZUX7
Entry Name LHPL2_HUMAN
Gene Names LHFPL2 KIAA0206
Alternative Gene Names KIAA0206
Alternative Protein Names LHFPL tetraspan subfamily member 2 protein (Lipoma HMGIC fusion partner-like 2 protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 228
Molecular Weight(Da) 24486
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLL
Background
Function FUNCTION: Plays a role in female and male fertility. Involved in distal reproductive tract development. {ECO:0000250|UniProtKB:Q8BGA2}.
Pathway
Protein Families LHFP family
Tissue Specificity Expressed in all tissues and cell lines examined except brain and peripheral blood leukocytes. {ECO:0000269|PubMed:9039502}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8733225

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human LHFPL2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.