Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens leptin receptor overlapping transcript like 1 (LEPROTL1), transcript variant 1 (NM_015344). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O95214 |
| Entry Name | LERL1_HUMAN |
| Gene Names | LEPROTL1 My047 UNQ577/PRO1139 |
| Alternative Gene Names | |
| Alternative Protein Names | Leptin receptor overlapping transcript-like 1 (Endospanin-2) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 131 |
| Molecular Weight(Da) | 14428 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW |
Background
| Function | FUNCTION: Negatively regulates growth hormone (GH) receptor cell surface expression in liver. May play a role in liver resistance to GH during periods of reduced nutrient availability. {ECO:0000269|PubMed:19907080}. |
| Pathway | |
| Protein Families | OB-RGRP/VPS55 family |
| Tissue Specificity | Widely expressed, with highest expression in heart, testis, adrenal gland, thymus, and spleen, and lowest expression in lung and skeletal muscle. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |