Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens late cornified envelope 3D (LCE3D) (NM_032563). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9BYE3 |
| Entry Name | LCE3D_HUMAN |
| Gene Names | LCE3D LEP16 SPRL6A SPRL6B |
| Alternative Gene Names | LEP16 SPRL6A SPRL6B |
| Alternative Protein Names | Late cornified envelope protein 3D (Late envelope protein 16) (Small proline-rich-like epidermal differentiation complex protein 6A) (Small proline-rich-like epidermal differentiation complex protein 6B) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 92 |
| Molecular Weight(Da) | 9444 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSCQQNQQQCQPPPKCPSPKCPPKSPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRPNSCDRGSGQQGGGSGCGHGSGGCC |
Background
| Function | FUNCTION: Precursors of the cornified envelope of the stratum corneum. |
| Pathway | |
| Protein Families | LCE family |
| Tissue Specificity | Skin-specific. Expression was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Not expressed in the cervix, rectum, lung, colon, or placenta. {ECO:0000269|PubMed:15854049}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |